SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|173504 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|173504
Domain Number 1 Region: 38-162
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.9e-20
Family Spermadhesin, CUB domain 0.00082
Further Details:      
 
Domain Number 2 Region: 228-270
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000955
Family Spermadhesin, CUB domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|173504
Sequence length 288
Sequence
MVVAAVAIQIDHVVSSYLSAGNFNNKNCVFDFQTRPNSKWGSFRSPNHPNHYPNPITCVY
YFRSYPWERVVIEFVEFDLDFSHGDAFNPDKCDFADTLLIETQQQTMQQNSKQQQYNRIG
IYCGKKLPPRTMSSGSNMRLTFTSGTFRFMNSRGFYAKYEFVNDFKVNSLPMVQDRNNEC
KFYYSSFQAEASTNIATISHSNNNQLSSYHSYYQQLQQQQSQLSSRNKGYFTSPNYPGLY
PKNTTCFYYFRTDPLKAVVFNFKHFEVDDKSLTFEKNVSACNKKNKQA
Download sequence
Identical sequences T1F6W7
XP_009018358.1.102002 jgi|Helro1|173504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]