SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|174106 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|174106
Domain Number - Region: 41-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00407
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|174106
Sequence length 203
Sequence
MTNFKILLVAIYFSTGVLKSQTSALAPLEKSFAELYFETLKEHECTYQAAYECSKAGHGY
CVFDDVCICDDGFAGERCTENLLRWEDEGMYERHDEPSPIIRRWMEFNDVTSVNVTWPTY
TGITKEVADSKCQEVYGEKNPYKTICHDNRTMVEEEIWDKCMLGIQMTGQLNGAYAFFLD
YVTGISCSYVDPEMVKNQLLNKI
Download sequence
Identical sequences T1F7M1
jgi|Helro1|174106 XP_009018900.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]