SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|174479 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|174479
Domain Number 1 Region: 51-87
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000541
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|174479
Sequence length 459
Sequence
MVAATVMGPMNYDEELEYRRRIKDPTFNVPVDEEGINKYGQLCDESEVRIQNCSNGGTCF
KVVDVPYRRSLVCRCHNNFTGDLCQRTKGGLIEQTEFQNPDLKMNDVQEPCSKWEDDIIK
CRNNGTCSKIQRGMMIPKRRKVVKKDLNLSKLEASKVDELVTSGNAEHPEVCESDGGDVH
GLNTSVDPGVNSRDNFRDNPLETSFKTKMKYDETDRDEFWKDMERELKEECRIAACVTKI
RKEIDKGNDVPELYVGKIWTQVKPKLCSYRNSRIKPQRNVQKNSSSIFRPMYDVTKRLKL
VESISLHDWDDGVKKLKYLKQYQRKRVTTNELELNETNMDISVGISSDCNVENVTYEVSQ
PAYSSNKKAETDQAKKRNPNDNTKSEAYSKNKSCNLKDNKDILSDWRNEQADLLLSYLEK
EILGTDTCEAASTGNFSRSHNLRQRSTIADKNEIGGHKY
Download sequence
Identical sequences T1F860
jgi|Helro1|174479 XP_009020177.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]