SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|174638 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|174638
Domain Number 1 Region: 195-357
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-36
Family MAM domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|174638
Sequence length 360
Sequence
MVKHGWYSYKRRQSSQGMKYLQKDIQIDLYVLFFTQLFSVISYVIRKPHDVTIYAVKHKD
QLLHTHKFMNKQTKKHTNKKTHTVAVAFDDENTEPEEQKNLNVALNNYYETSHKLSELSA
KHDVCRSDLQSQTDLAHHVTSLYYEEKEKYENKTYELQESRDELRVLGSQFNHQVTLIDV
IRGKLDLCITNQMLGHCEFEDERICGFSQDYLDNVDWIWSNSRNNTKYAPHVDHTCESRN
GHFLVVNITTKENGQKARLISPHLFGYEEQCVEFFYWIHGSRDVGYLNVIAKIPDTNEED
NLWRASGNQGNVWIQAKVNVQKEFVRAGYKLIFEATIGRGLTGEIAIDDFKITNGVCSYK
Download sequence
Identical sequences T1F8C0
XP_009020330.1.102002 jgi|Helro1|174638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]