SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|174796 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|174796
Domain Number 1 Region: 230-270
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000183
Family Spermadhesin, CUB domain 0.0039
Further Details:      
 
Domain Number 2 Region: 44-175
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000798
Family Spermadhesin, CUB domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|174796
Sequence length 277
Sequence
MNDSETKRRKFIHVGSAPVQLKIASQSAKNCIAYESTYQVEKDCSCLIFMSNGGSSGYFS
SPDYPFRYPANISCILYTFVGEADEIVEINLISLNIFGDDDGVTNADAGGSNEGDNTCND
YLSFFLNIERPEIMDRQLPDHVICGNLTGNGKKYYSSDRSLIVEFHSGPRAKNTGIKNKN
IKTNNNINIYNINNNIGFNASFRFIDKRGSLKWGTKCSYDFRSRKTIKIGVLFSPHYPQT
YPTNVTCTYNFYALQTEVISLTFTHLKIGRGDDDDER
Download sequence
Identical sequences T1F8H4
XP_009020485.1.102002 jgi|Helro1|174796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]