SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|174798 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|174798
Domain Number 1 Region: 88-131
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000445
Family Spermadhesin, CUB domain 0.0043
Further Details:      
 
Domain Number 2 Region: 18-51
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000327
Family Spermadhesin, CUB domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|174798
Sequence length 134
Sequence
MTLPDDLRPPPTSPAISDPANYIFCGSDKPPTLMSSGNKMAVVFSSTSETEKIKRPDDGF
GGFRFRIKYSYTTACKFTYRSEPNLDHGSFSSPNFPGLYPLNTRCHYQFIGQPDERVVIR
FEYFDIDGLPNRYI
Download sequence
Identical sequences T1F8H6
XP_009020487.1.102002 jgi|Helro1|174798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]