SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|174990 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|174990
Domain Number 1 Region: 59-245
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000091
Family Ku80 subunit N-terminal domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|174990
Sequence length 956
Sequence
MAEGEVQPDLPECLRLSSAEVVSILALRMASLNKPNKIPCKQTRPRQTYIQASTSPKVVI
FLMDVGDGMKNKMELAKKTVKLFLDTLTDEDYFNVIFVGFLLHFSSTFNYAELCFNFSLL
LASNENKNRVVTYIDNYKWFKSKTSYDDGVKEALKLISTLNNSMYMNHICERSLVMLTSM
LTSNIQTLISDINRHPFFKVKPFIYLLGKDKSSRNLARDIACSNGGFHARIDSDEQIFEQ
LLNFITVLSNSSITSNREITWTNIYEDTAGLDLIFTIAKPVQVNKKFIGVVGVDVAIVEF
ERLFNSFQLGVDAYGFIITESGNVVYHPELKAKIKEAMMRRETAYMNINSVGLFDNFKRV
NMRRGNCFFTPIDHTSFRQYCSFDLKEKMNSRSETLYHQLKIAQTNSKIYTEKCNEELVM
NLLYDIEATRGASNSWMKENWDSKHAQIRSDGVDMVYFGTKGGLTRYFVFNQTNQELFED
YLEQTAVSTSQSLYYKRAINGGEDVFTFSLPFLIESSMNNGDSSSSYPLQYQPPSHLYSA
NMDDILISASAPVVIHNDVSEGVVGVVGLLMRYSQFRQILNETSISLCRLGEHQPCVKTC
ESELGYFLGELEGCAPRILKDLIIRNEEESNLERDPNQDGYHHHHHLANLGDATKNSGIF
NKIEVTDHQAVCEIIRKSSSNSEALSNNLSFTVLLNKLVWILSEVYIFMSHIGSVGAFFG
FKQTTNETTPPLPVTAFDEVPPDLETYRVLMTDLMKISSAEQAGKWKDNCMRQSGFNADV
ALACLRSIKKAYEPGILGFRPCIQSYTRYEREKVRLPQNGRINKKERDICTKPYLITDVP
HTNLMLLATDTTCMCEDTPTISSRPVEVVRDPAAMEGTCDKLTFDPNVQQLRPTTSSSVP
PSLSSSTSKCSVRVQHEDDMSWNQDETSQSETGSHFCGDGVSIHDLLECLIEYELS
Download sequence
Identical sequences T1F8P7
XP_009020667.1.102002 jgi|Helro1|174990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]