SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|175027 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|175027
Domain Number 1 Region: 283-484
Classification Level Classification E-value
Superfamily Kelch motif 4.58e-28
Family Kelch motif 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|175027
Sequence length 567
Sequence
MKKNEDDLENKDGSTAKQIVLISKTGGRHQVERNIFHQTSGYFQKLLKSEMKDANCRELS
LKCLTNESLIEVRNCLSKLSSNEMESLKSLSEVEAGLDGAYYLLINDMIDSYIDLLMKHL
NKSTCIHILDIADKYVLINQVVEKVIKYMLKNVKELSENSKMLLSPEEMFRFVGSEMDVF
NFIIKWILEDQSRKCFTEKLLTEVRYSLMTPTEIQKCTAILHDLNLNINYDKDNDSNISR
TDVDSNCYNFLPVYDFVETCKNISDRTGPSATVINPTWRQEPHLVLSHIRACVLDNCLYL
VEEKWFMPYINSAVHSYNPVTKVWSKCCSMHIQRLNFYLGGLDGHLYAVAGTTYDLVEIP
TVEKYIPSENRWHMVEPLPLALEHVSEFIEYQYDPSYNKRFSRAPMLTARCCHVMTSVGY
KIFVVGGQFKHPDMEPFDEFYEATDGEMYDAESDQWSSVVKLKSPVWNSPFITINNCLYT
FHQNKWNTFVQKINLAKLLNEKKTSNDSSLSSMQDRNANNNNGAEKQNYPCVDALTYDDC
QLLKWLPADGTYPFDCQYVGVMVTSDV
Download sequence
Identical sequences T1F8Q8
jgi|Helro1|175027 XP_009020715.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]