SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|175087 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|175087
Domain Number 1 Region: 506-772
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 1.18e-21
Family SGL-like 0.077
Further Details:      
 
Domain Number 2 Region: 15-76
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000123
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 3 Region: 178-236
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000504
Family B-box zinc-binding domain 0.0024
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|175087
Domain Number - Region: 113-157
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.015
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|175087
Sequence length 781
Sequence
MASSDAECESDLEEQARSLTTCSICMDQFTNPKVLPCHHTFCLVCLKNCYESVNKTRLIA
VSNFPCPTCRKTCYVSPQGLEALPTDFRIAQILDLMSAIESSLQSQQKSKTKQNFDFGNC
SICRFQRRERHSEGFCLQCEKAFCSQCLSHHGKTKIFQDHVVLNDKQFGSSDSGSQNKDP
EKCGEHDADYKYFCEDCSTLLCTVCCLFSEHNSHSIKEKSSAVSLYTTQLAAMESDLKSK
LAKTQPMKEQYDEMKKVQMKNYEECESDIKAAAKQAVATIEKMETQLLMNLINNHDNSMH
ELSEVSSKLNANFEMCQKNIELVSQLKSQPGSRDFFVDFNQIKQSVSLMPSMDNIKPAIQ
PDTFKFVLNLNVSLGTLVKNKKVAESTATASSSSNQSTKEHSVRDQQIMRKESFNNKENK
SENLRFKRFDPLPKPAKISKLQVSTSTLNIDQPPPNLNSTLDRKDSLTVPKQEAPDKIIK
TLSRRLSGRLSRTALQTTIATSPSRKKLHWVAEGFSQCRDCCFMKLADQWLVVACDYKAT
NAADRIKAFDLKGNLHHAINTRQVVEPWSIIFQSSGNSIIVTDHASRAIKRIQLDESGKC
SRVLTMSQSYLDRPTGISMTRCGDYVVTDSGNRPHRLAVYFQTSNYVERKLEFGNRGKGD
SEVGLSNYVVVDHRDRVIVSDIEERHVKVFSAEDGSQILKFSCSCSFDGTKEMEPQGVAV
DDANNIFVADQAMRGIAMFSGEGQLINNVVSTKGSPWGLAYLDELRILAAATDKGLEVFE
L
Download sequence
Identical sequences T1F8U2
jgi|Helro1|175087 XP_009020772.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]