SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|175161 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|175161
Domain Number 1 Region: 194-338
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000797
Family Integrin A (or I) domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|175161
Sequence length 408
Sequence
MLKSFFIIYSILQLLTGTHCDISNNIVSKLLVDMTKFETIQKNYDRNGPSVEVVKVSLDE
VTNVAITLSRKLQNYREEFKTLLNPDDVLWAREANKSETDKSFVHIPIDIFREEKDIMEA
ITWTSLLDPLWDDLLNTFTEIKLQFFGSTTGVMRYFPGDKWTSRELDKDEKPIDLYDVRR
RTWYIEGMSTPKVVLILIDSSGSSQGQALALMKHMSKQLLDTLTENDFFDVLNKSWEYIE
AMTSLGIANFTRALENAFILFNNTASYDESNRLFGPHCNKMIMLLTDGGNEKPADLLRTY
NKYLQIRIFTYLIGPISTHAPAIKWIAEKNRGKFYQIPSIVAIRSQTQDYIRFLADSKAQ
SNNWLTMTTARYDQMSNDLVLTLVYPLFNMSHGQERMRLLVDQGFTHI
Download sequence
Identical sequences T1F8X8
jgi|Helro1|175161 XP_009020843.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]