SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|175238 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|175238
Domain Number 1 Region: 397-558
Classification Level Classification E-value
Superfamily Integrin domains 1.88e-34
Family Integrin domains 0.00048
Further Details:      
 
Domain Number 2 Region: 257-393
Classification Level Classification E-value
Superfamily Integrin domains 1.62e-21
Family Integrin domains 0.0018
Further Details:      
 
Domain Number 3 Region: 4-85
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 3.14e-19
Family Integrin alpha N-terminal domain 0.00059
Further Details:      
 
Domain Number 4 Region: 85-252
Classification Level Classification E-value
Superfamily Integrin domains 3.92e-17
Family Integrin domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|175238
Sequence length 606
Sequence
MAMYTDLAVGAPYEGDGGAVYIYRGSKLGLIETPSQRITPQLFGQKIQTFGYSIIGGTDI
DGNNYPDVVVGSIESSSIVVLRSRPVLNITASLTTSEEYIEIQQLLNPDRIKESIFSLKV
CFTYDSQFQKNNENNTRDIPKKLKYRIKSETLAGTSIHRVYFSAFNGSSNVKHSLNLQNH
KAPQCENYNVFLNKNNKDFLNPLKFHLYYDLDHGDAQATSKSREKLNDINQHPILDIHCK
NISKSVHFRKNCVKSVKCVSNLKVSANIDKPEETSKNEYKILVGEKKDLLLHIKVTNNDE
EAHEAMLYVYLPEQIKYKGTDDQGKNYQCEYNNNIVSCLIGNPMPGVNHQLTYALRLDPS
DLKPDMQNINITVAVNTTSAELDISDDSFTLFLKVIVQAELKVKGRSSPSDVYFGGEVMG
EQAMVSEEDIGNIVVHSYEMKVSWGGLVKSSTLEIEWPYELTNHKHLLYLVDIEYEGDVV
CNQESLNKLQYRRNKKDCDRGTAVCVNVKCHIGALTSGESVVVKFISRLWNTTFLQAYTV
IMPDQNLGRPKKIELWVIIAAICAGVLLLLIFMLVLWKCGFFNRLRHDEALVHQAKVVNQ
PLNQQL
Download sequence
Identical sequences T1F919
jgi|Helro1|175238 XP_009020931.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]