SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|175614 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|175614
Domain Number 1 Region: 2-88
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000226
Family Laminin G-like module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|175614
Sequence length 160
Sequence
MVKQKKLNTASLISFESQSGHVLFEIESSAISKELRVHYRHDDVDTTLTSQQDISDSRWH
SIIASVSRDSHLTLYVDCKVSLSKQLHSMDLYKKFNSIKKLSKSSSSSSSLLRNVWIGQR
NADSMFFKRLTRSLHFKRISWHFDTCFIVLILSRGSTILD
Download sequence
Identical sequences T1F9F5
XP_009021273.1.102002 jgi|Helro1|175614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]