SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|175670 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|175670
Domain Number 1 Region: 529-641
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000895
Family I set domains 0.026
Further Details:      
 
Domain Number 2 Region: 109-173
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000305
Family Ovomucoid domain III-like 0.011
Further Details:      
 
Domain Number 3 Region: 720-783,817-1004
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.0000000011
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.026
Further Details:      
 
Domain Number 4 Region: 455-536
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000352
Family I set domains 0.033
Further Details:      
 
Domain Number 5 Region: 298-402
Classification Level Classification E-value
Superfamily EF-hand 0.00000147
Family Calmodulin-like 0.056
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|175670
Domain Number - Region: 179-265
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0523
Family Phase 1 flagellin 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|175670
Sequence length 1083
Sequence
MKFTWVIVIVVVMVIVMTMLAETTQAKSSRYFKRVKAFARRVSEMEARVDGDDDKNGGGD
DDDDDKNGGGGEDDDERRNGDDDDWDYDNKEEDGGHVKRRLNKDACQGLYCRTGRICRLS
RDGHPRCVCAASDFCQGHKSPVCGSDGKVYSSHCELHRVSCHEGSKLGVDHTGKLCHSLS
NHTSSAKIDKIVDVAAVVDASTTAAVGEVDFGKPNNESVTTVKSTPTPRLTTIHAASNTA
VINHPGTTITTTTTTSNAATATTDSQIAATTSHPTTEKNKKAKIVSPSSSLSTSSGSEFG
EDKCSHLNYKHFKTNLIHYQCARTGNNGCTADHQKKTLAVTAMFDFYDRDMNKLLTREEL
DHVEHKDHIDRLSRFCHLTHIMLFDDLDDDEIINIDEFYRAFGGTVPLPVSSLNPPLRKR
TKTHLQKLKYLHKGHSGVKESSSSSSEDAPTTFTTLVSVGNAVELKCDIPGSEAILWKRR
GQLLTSSDDIKIFDDNSLYIGELRLHHMGNYSCHDAKRLDVFQTHVIIVQMPPLVRIHPA
KQTHSMTSQSASIRCHVSGVPLPEVIWMKDGGQLPLQQQQPAGEKSSYALYNSNTTLEIR
PVLNLANSSSSSSSNNNNIGGLFTCTARNSVGNSSATASVLFETNVPNDAKHTDSDETRQ
LERFAVFHNSGYTIYELTNCHIEHHVFAGFELSTVQRGHTSVDPVKTLCLNSRSCVWGDS
TMAKESYLYVSQPHLRRVLVIEVVDRLNPVEVIETGLPPHQLTYIEHLDQIWMTTCNKSL
YQHGDLSVKDCDEVVVMIIQQASKALKHHVVHMKNVEPPNFIIEKLFLPHHDEPLDGAFN
QGYATSKSDLGYLHVIDLNSMRFVDRINLTEQKCSPQDVGYVPIGGYLFVSCKQFQESPG
SNFHLVIDYITHEIFKKSDMGGGAIYVSPDSRHVVVLEEDGSGISVYKFTADGRLNHSFD
EYTQLHLNDISFYRAETGIGYNAYATSYVQNTILHLELLTGKVNMIEGAEGTFTPDDIAW
NRRFRKVERGGPFFGHLMTSSKNSITGLDGQKKHIQCHWQDVEKTTTISALPLVDDSGVA
AGI
Download sequence
Identical sequences T1F9I1
jgi|Helro1|175670 XP_009021324.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]