SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|175671 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|175671
Domain Number 1 Region: 489-632
Classification Level Classification E-value
Superfamily vWA-like 0.0000964
Family Integrin A (or I) domain 0.037
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|175671
Domain Number - Region: 726-791
Classification Level Classification E-value
Superfamily Sensory domain-like 0.000212
Family YkuI C-terminal domain-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|175671
Sequence length 1443
Sequence
MFWSNQAVFVTISSCFLAFINIVVRSQFTDRYSLDDDKYARLSSLDKVPAPVYNISGGVR
DQLLPVVKNINLMMSSTKKSNSLQFCSFFNNRAPQEQLALKNCTWYSKNSCCLQHEIDVS
FSRVKSLIGASEDCQKYTNYLMCYVCSPDQNLFYKKERLTVCEPFCDLLYEACKFAYLKG
YQIADLYSTGKEFCLSRRFLVEYRHDCFNMHDVNFEAMKFSSSSSSSPINFIHICVLIFV
STILSTGSFIGKDYFMSVGGSKFKIHQTTGRGVCILVIISIFMLSAQHTHAFKVSFDDVL
NLRKELSNFFKKLEAETLKNDLYKSLLTSQVPAKKTGIEVLNDVKKTIEKFLADKRTTLK
SLSVHLRNAHNITLSSQQTNSSGTANDTNTENLLKNLKLPLSMRSYRNKSMASQLIIPES
FDELNQEVINFYDFTEKFDELAKNFVDQYTRSVYIASRTGLMRFYSNLTLKSPFDPRSQP
WYMGVKEAPSHVIIIIDTSFTDEKDRASFNRSKKIAQLLINSLAAHQRVAVISSASRAWH
NKGLLQDGNATNISECLIETSSKLSRLMKATNGNKKMLTKAVEMLTPFGGSDHKNGFMLS
FELLERQKRVHRKYLDCRSVVLFVTDGDESEFSLRCSEGFYQFNENNERIFQKGSMCDYK
NDELLDTIQWRQSRIPGTKAKIFTFLTKESKKWHHSFFPGKLACQNNGAMSRVYHDSDLF
NQMAPYFDYIRAREYSMDPILTGPYESSIDGEPILTLSMPLLPGNNINAKKIIGVIGMDI
SLSAFESLIHEYHDFTSIINLNDGGAIIHPLLPKSYEGVGKWMDIPIMDLEMYEEEGDNE
GTAAATATTLATANDKYYDDDYDDDNDDKHDNLIRNNNKFKKSDHDAFPYVLKNMLRKKN
GSHVITRGVNIGVAMKEGYILWKPAKSAYCFYDKINDTHFGVLLKAYSQTAATGFKPTDR
LFEVLDDDSTKTVYKKEHLFRDKSTQWLHTWIFSTPSIPITLDASSIVLAPSAFCHSHMS
GMQYNIDKVIVQESINKRPRDDDKVREGSGESEADIDGEESEERWYDALLGKEKNCLITK
EARVAIQFSKMLTYSWRQAMARDRNLRSVYMASIAGVIRHYPGVLVPENRVLRPMRYKWF
LDAAMHTSSLNVINNRLPFTTSNNVITISRTVEETNSKNDGEIVMSLSDKLDGHRFNTLQ
HEFNFIFRSLINKHMIKVHKITRILPNCTKPTTEADKASARSAAKAAVSAATAVHHPPND
TVLTASFTLTTVTTVSGPQHTRACMTIVQRPYIDLQKLRKLNGVISGYSTKEVKENGEVI
ADDPCYTGVFYLTSIEGTDLLFLTLIDVNITNSDFCKNERTKSLKAFAEHMKPLCPLHEA
YYATRSNSTTCPNPRFISLYCYYNRAATDHVAIKYRLLMYMVVYLSVVHAFFEHTFLFGM
YTF
Download sequence
Identical sequences T1F9I2
jgi|Helro1|175671 XP_009021325.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]