SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|175690 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|175690
Domain Number 1 Region: 4-162
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.92e-17
Family Laminin G-like module 0.009
Further Details:      
 
Domain Number 2 Region: 191-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000963
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|175690
Sequence length 338
Sequence
MQFQAWKACETSVNTLHFDFETRRDGALIIYSQSNSANSFEFLEVKIVRGQLKIRYKVQS
GNHETLQVCGDSLDDGSWHNLNVTYLKSNFTFFVDGYKCSSKYNLPVRKNLLSPESIEYR
KAGTEDDDGYLFIGGIPKNRFDKPLKLSSVKYQTTFQGTIRRAMKSDCGGVADDLTLLGG
HGVKSEVEDVCAVNNVCKNGGRCISSDGGPVCECHFTNYDGVNCERDAIKTANRPVIIVF
AFVSVLVGLHEYSLESHGDVLMMMASDHVVLAAKSGTVILSGREVPQLTNINDYISNRGQ
IVSFTSPSQKRLPEKPERLNICLIFKVKYKIKKYKPVK
Download sequence
Identical sequences T1F9J2
jgi|Helro1|175690 XP_009021339.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]