SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|175729 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|175729
Domain Number 1 Region: 5-74
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00000191
Family beta-sandwich domain of Sec23/24 0.053
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|175729
Domain Number - Region: 408-445
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0209
Family Spermadhesin, CUB domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|175729
Sequence length 594
Sequence
MDFRNYISPFFYHLQQAYLRSQQQQQQQQQYQHQHNLGSKYLLESVLQQQQQQQQQHQPQ
HEHRKFYQHPLIHPSLAHYGTKKYSNSSNNIINTNDFEKTKDDDDDDDVMTSHNDTKSHV
DILPEDEADNDDDCIGVESVGLKTLELRVASEGIVRGALRRFCVTLVCLTVLMLSSKESS
QTWHGTRTHPHLSYSHLLYCSQIFDYSQALIFTLFHLLTSFVLQAVSCLQCVSKSYGHLG
CGNDVTEKFESFCSGRGSCSINVISMHNLLSGVCPPDLKAYLEVAFICVDVLRLPDQYND
NSQNTFLLSSSSPSPDLPTKFSSSAAKCLTNDLIEFQNDEHKRASSSSLPPSSPATPSFH
SSTSISSSVSLDFSRMGYLASHTWYNKLKPSSSSQSSQQPSSPSPSSSSPSLPPPFSSLL
ICPWLLVASDHQRFKFTLIDFSQPHLITAAPTTTTTTPTFTKQQHDSKNKSCLRYATITE
GNHLRRKFAKEPHSDSTDYLNSENRNDDGALGNFPTGRRLDTSLPPDVTTEHHVCRENSR
EMFVYISRTNRVQALSKYFEPIAKNECLQLPFEMRKRQIAITQSYRKIIPPFYS
Download sequence
Identical sequences T1F9L2
XP_009021384.1.102002 jgi|Helro1|175729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]