SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|175871 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|175871
Domain Number 1 Region: 261-423
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.69e-20
Family Laminin G-like module 0.0063
Further Details:      
 
Domain Number 2 Region: 141-225
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000302
Family Laminin G-like module 0.019
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|175871
Domain Number - Region: 242-270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0067
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|175871
Sequence length 457
Sequence
MDGRKKLSGAEYRRIAKEKRKKESDVLSLTPKLETLFNKSNVNRPRMKRKMADELCNDEA
LTNVENMYQVTMLEIIDRVITELSDRFESLNNVNSMFGFLSGVKIKEMQTADLKIKAENL
ANIYSADLNIDEFMFEIESFKHHALTVDKKIITRPKPNQLKQTFFHWPQQPLQLGGIYNM
NMKPTFKGFKGCLRNVMFNEILYDLHTEPTLRLFSNVVDGCPQDHRQCKQIFMDNENIKK
EKNNICGPNSFCDRSQDEYACVCEPGWSGGSCSEATPAVDYLDDSYIEWIVLDHVHELFA
STQYRYETRIQLMFKTRHDRGLLLKVQNKNKSKYLSIEILSKKIILKYNFGGTKRKILSL
PYIDVDDGRWHNVNVIRAGGWVRLAFDSFTGFYNNESYTSDEAMSPFFIVSVISGGVPKI
IYSRNKSFVDDPGNIIVDSDFKNGKNHFTYYNFSCFI
Download sequence
Identical sequences T1F9T1
XP_009021490.1.102002 jgi|Helro1|175871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]