SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|175872 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|175872
Domain Number 1 Region: 150-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000888
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|175872
Sequence length 263
Sequence
MATLERKQMALTTYMAVLAMENEMKMATASLSLLKVTDERIFKDILYAKLVRGKRTIGRP
KLAYRDVCKQDIMTSDIYGTCGKRLFGIEQHGDKVFEMILWRENLKDLKLPLAGCIKDIR
INDFLLPVSQTEISKASFIINSLKNVLPGCHDYDFCSNLQCILPLICVSRWRHAECTCPN
GHLRIEDKRECRKVSFCHETDNLIDVDYKEDGDLCGQQVLSDCDGKEGYDEHCFMINEEL
TTSKTTKLLLFVFISIVIFIGNK
Download sequence
Identical sequences T1F9T2
jgi|Helro1|175872 XP_009021491.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]