SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|175872 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|175872
Domain Number 1 Region: 150-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000888
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|175872
Sequence length 263
Sequence
MATLERKQMALTTYMAVLAMENEMKMATASLSLLKVTDERIFKDILYAKLVRGKRTIGRP
KLAYRDVCKQDIMTSDIYGTCGKRLFGIEQHGDKVFEMILWRENLKDLKLPLAGCIKDIR
INDFLLPVSQTEISKASFIINSLKNVLPGCHDYDFCSNLQCILPLICVSRWRHAECTCPN
GHLRIEDKRECRKVSFCHETDNLIDVDYKEDGDLCGQQVLSDCDGKEGYDEHCFMINEEL
TTSKTTKLLLFVFISIVIFIGNK
Download sequence
Identical sequences T1F9T2
XP_009021491.1.102002 jgi|Helro1|175872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]