SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|176036 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|176036
Domain Number 1 Region: 198-235
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 0.000000000432
Family Nicotinic receptor ligand binding domain-like 0.01
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|176036
Domain Number - Region: 46-136
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000719
Family Pentapeptide repeats 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|176036
Sequence length 236
Sequence
MGGRCWEPDAWKVDTCEVDAWKADAWKEDALKVDAWEPGTLKADAWEAVAWEADAGKADA
GKADAEKADAFEPDAREPDACETDVWKADAWEADVWEPDAWKVDTCEVNAWKADVWKVDA
LEADAWDADAWNADIKNLHKNSLNCFLYMPASCITTQTSKNKTKIMSNSTVQCRCCANIM
QEQKNYSHGRESCFALSNVLWNDYQLQWDPSEYGAINVIRMLSHKVWKPDIVLFNK
Download sequence
Identical sequences T1FA23
jgi|Helro1|176036 XP_009021634.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]