SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|176481 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|176481
Domain Number 1 Region: 17-182
Classification Level Classification E-value
Superfamily Kelch motif 3.4e-30
Family Kelch motif 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|176481
Sequence length 262
Sequence
MHQTKVDFYFGGLAGNLFAVAGCLANYDIAVGLTPAVEQYVPSENRWYMAEPLPHAVANL
AGCVWNGTMFVSGGRDPWTRCLVYQYDPLCNKWFAKAPMLTARTDHVMTCTGNKIFAVGG
FVEADDDYPDEVEFIWPNGGDSRDGEMYDVETDQWTSVFNLWRPAFHAPSITINNCLYIF
GRNRYRNLQKINLAKYTKKKKTSNDSNSSSVQDRNADNDNLGVIDAEEQNSHTHDCQIFK
FNRQTKGRFKYHYVGVMFVSNI
Download sequence
Identical sequences T1FAK2
jgi|Helro1|176481 XP_009022089.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]