SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|176482 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|176482
Domain Number - Region: 310-345
Classification Level Classification E-value
Superfamily Kelch motif 0.00353
Family Kelch motif 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|176482
Sequence length 349
Sequence
MDAESDNVENKDGSRGEQIVLISKTGGCHQVDRNMLLRASGYYQSLVNSGMKDVHYRELT
LACLTNESLIEVRDYLSGLSTNVFESLKSLNEIEAGLDGAFYLQINDMIDSYIELLLKNL
NKSACIRILDIASKYVLNNQVVEKVIKFMLKYFKEIPESCKISLSPDEMLYLVASEEMNA
DSEMDIFNLIIRWVSEDPSRKCFAEKLLTEVRYSLMTTSDKQKCTDTILDLNLNISYDTD
KDSNISRTVGILFTLGSTKIKGQKKSFVDILPVYDFVEACKFSRDNSGPSPVKFNPSRRS
RPPCNVTRKACVVDNCLYLFEKWTNDGSFSGRVFMYNPIAAVWSKVYYF
Download sequence
Identical sequences T1FAK3
jgi|Helro1|176482 XP_009022090.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]