SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|176501 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|176501
Domain Number 1 Region: 625-674
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000467
Family EGF-type module 0.046
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|176501
Domain Number - Region: 814-825
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0994
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|176501
Sequence length 1069
Sequence
MTSIEITSSLLIVADQQMIDLSGDPEQPKQVGQKLPEQFQQQQQQPQLQPQQLLQQSQQE
SRPKQIQSQHLPQKPQQIQPLQQLQQQSQQQQLQQPQQHYQILEQLQQPPEKQLQQQLQQ
LSHDKHNKINEHDSLQQRIQQQFQAQLDKILLSPKTRRRHSGRRLRNKLKKQKQQQLNAK
LQQQLFQQQLLQQRLHQQRLIEQQKQFLQQQRQQQQLQQQPVLDSQAKMNKTKEVLFVQK
WFMDKLKNSMLSSSSSSSSSSSSSSSKEAIKTTTSTKTSISNTNNDNNNNNNNINNNINN
NINNNNINNNISNDDNYADAGNRYNKIIREYSSSSNNNNDNNDNNDEDNYEITSDNKDEN
EIHGKDDDDDDSELIQNDIMLSNDIITQKNKQNDDDDDDVDDGGGGGDDSSNTDVSDGGG
GGGGGGGDDETGDSKDESGYISNKNDLELYYNNDINNDINQIVDNSNNNIGDGTMGYNTF
RLDDISKLPGNVSLLSMIDVPFDGIDDNNSSSTKINNNNNNNIIISSSSNNQGISNTNNN
QDINSDVNNIDDDNDINNYNNNNNNNNNNNNSSNNNSNNHSNINVNSANNSNNNNSKTYN
NINSIKSLTILKDNIKIEPYPSGQLEKCDNKLCSARGSCYQDRSKIDGDEDVFCLCFIGY
YGRFCQFANPSLVQQPSSAQQQPQDSQLQQQQQQQQQQPQQQQPQQQQKQPQSFFVKDQQ
THFISRPQQPQQQQQPQQQPQQQQPQQPQQQNQPQSFFVEDQQTHAISRPQQPQQQQQQQ
QQQPQQQQPQQQQQQTAAVYIDYISDQNISQPLPPPPAQVPPPPPLLPAQQQLPPPPKLA
RSSAEDPNSHVIYLSDNDVIEKDSLFFGDDATSGEIGNLERDDDDDYYESFEEKEKEMLI
NCEGMFDLYYMRSMPTRTVLIVSISAFVILLIFCLMLVALVSGDRRVLLERYEVLVRLGY
DVNPPDDGFFRLLGRRLMFLCCCACYCCPWIDCCYCLQSIEDSDREIQIAMARNKSQNSS
ITKHDERQQQQPQQQQQQQQQQQLSASNISRTITWAPTTFGSPPRKLDC
Download sequence
Identical sequences T1FAL2
jgi|Helro1|176501 XP_009022102.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]