SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|176620 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|176620
Domain Number 1 Region: 2-65
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000668
Family Ovomucoid domain III-like 0.0092
Further Details:      
 
Domain Number 2 Region: 132-164
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000176
Family Laminin-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|176620
Sequence length 168
Sequence
MVVCRFGAVCDSTDVRPQCTCWHNCSYHFQPVCGDDLKTYMNECHLKLQSCWKNSEIKIK
ANTACESKHASSNNISSSNNINNNNNNNIINNSNNNININKNNNKNNYINNNININNYIN
CTLVGKSCSERCGCNPIGSYGQWCHPISKQCTCRPGVGGLKCDRWLAV
Download sequence
Identical sequences T1FAQ8
jgi|Helro1|176620 XP_009022196.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]