SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|176662 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|176662
Domain Number - Region: 59-182
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0157
Family Pentapeptide repeats 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|176662
Sequence length 235
Sequence
MKIEKRKEIDRSAKKRLKERYLYRIYALYNSIQLYTTLYNSIQLYTTLYNSIQLYTTLYN
SIQLYTTLYNSIQLYTTLYNSIQLYTTLYNSIQLYTTLYNSIQLYTTLYNSIQLYTTLYN
SIQLYTTLYNSIQLYTTLYNSIQLYTTLYNSIQLYTTLYNSIQLYTTLYNSIQLYTTLYN
SIQLYTTLYNSIQLYTTLYNSIQLYTTLYNHAYYPIQSINPTKTRNHRVPVICMV
Download sequence
Identical sequences T1FAS1
jgi|Helro1|176662 XP_009022284.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]