SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|176719 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|176719
Domain Number 1 Region: 14-134
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000171
Family Laminin G-like module 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|176719
Sequence length 253
Sequence
MTYFVDDTNCSSKFAGFAMNVGGNVYAVYNLGSFDTSVNDLYTKVNDGQHHVVRFYRNGS
NSTIQVDQEEPRFKKLSGRQLSKFNGQSAIFIGSLRTAGKLTKSFQGILSGLVWNGHHLL
SMASSRDPRSKIEGQVEVNRKSMVNNYMKLVWESAQVKRKDAMRCGRLSEWRANCKEGLN
VPLVIQSYEDIIKITYLLLFLSISSFLRVHVRADVFMKRYVGGRDSLVVEAAWRSVLGSQ
ARIRIGQEVPIPN
Download sequence
Identical sequences T1FAT8
jgi|Helro1|176719 XP_009022319.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]