SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|176894 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|176894
Domain Number 1 Region: 113-265
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.07e-28
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00071
Further Details:      
 
Domain Number 2 Region: 4438-4547
Classification Level Classification E-value
Superfamily Cadherin-like 5.71e-18
Family Cadherin 0.0025
Further Details:      
 
Domain Number 3 Region: 3883-4007
Classification Level Classification E-value
Superfamily Cadherin-like 8.9e-18
Family Cadherin 0.0018
Further Details:      
 
Domain Number 4 Region: 16-114
Classification Level Classification E-value
Superfamily Kringle-like 5.8e-17
Family Kringle modules 0.0016
Further Details:      
 
Domain Number 5 Region: 1484-1729
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000000115
Family Galacturonase 0.057
Further Details:      
 
Domain Number 6 Region: 299-611
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000000272
Family iota-carrageenase 0.085
Further Details:      
 
Domain Number 7 Region: 4214-4328
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000928
Family Cadherin 0.005
Further Details:      
 
Domain Number 8 Region: 2367-2449
Classification Level Classification E-value
Superfamily E set domains 0.000000000021
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.022
Further Details:      
 
Domain Number 9 Region: 4326-4418
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000842
Family Cadherin 0.0077
Further Details:      
 
Domain Number 10 Region: 4105-4213
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000214
Family Cadherin 0.0049
Further Details:      
 
Domain Number 11 Region: 4000-4101
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000811
Family Cadherin 0.022
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|176894
Domain Number - Region: 4540-4622
Classification Level Classification E-value
Superfamily Cadherin-like 0.00012
Family Cadherin 0.0057
Further Details:      
 
Domain Number - Region: 2921-2984
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.000259
Family Cna protein B-type domain 0.0086
Further Details:      
 
Domain Number - Region: 2491-2576
Classification Level Classification E-value
Superfamily Cadherin-like 0.00188
Family Dystroglycan, N-terminal domain 0.058
Further Details:      
 
Domain Number - Region: 1813-1850,1915-2200
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0046
Family Galacturonase 0.048
Further Details:      
 
Domain Number - Region: 690-981
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.044
Family Galacturonase 0.044
Further Details:      
 
Domain Number - Region: 2464-2486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0628
Family EGF-type module 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|176894
Sequence length 4650
Sequence
MPKLTVLAKLFLITAALFNNIVSASDCMSKDGTYHGNLNVSASGQRCSPWLSTKPCSKGV
SDVNATFTHNFCRNPVEPASCHHERPYCFLDSSNNLWEFCDMPICGSEPSTTCLNALGLG
DGRIRDDQIYAPTQYDDSFKPSFARFNNSNTNAWRASVNYPRYVYLTVNLTAIYTITKLA
IRSVSTASYYYVSTFKIMYSNDGFSWQFYGNGADDLAEAHEFEGNHGNSDISVVYFDTPI
QAILLAIIPTSYSLLPTFQLELYGCLAPTIVSTKTEITQNINSNVFWSKSSSPYIIRSAI
LVGVGVTLTIEAGVKVIFVGNTASLTISACNNFAVRNLYVRGSGLTTNLKTISFSGLVVK
NAPKAVSLTNYENVTFSNSLFKSNQIGIVALRSQLTIYACRFLNHEDAALKIDEYSDDTP
LVLSISDSLFQNNFYGLYIHKSQTYSLPNDTLQIINTVFVNNKFRAIRIYNYNYVGVNFI
SFLIQNSTLSANLEIPFYLYINNNANITITQSKFINNYGTSALQIFLLPGTNFKSLLRID
SNVFSNNTMDETIALSAESPSEVTISNNQLVNFNTPYEIACHAPYIKGFGYNADLNYWAT
TDTRNISDRIFDMYKDSTRSFVRFSSILKNESRDSLLVLSDARALYKFNGTVGDLLNISV
QSNFKFCTVCVRSSVNGNIVLSSLEAKGYNVTNTIFVTNGGCLTIQGPLQLKFKTATGIV
VEGGCLKIDGNVTLTSSDKQWNGIKFLNSNGSMLKNIFVNASIWPLEIINSSVTVQTSTF
DSQNFLKFSDQSSGKILLDGLNVKCGDMCVEIFQEFVLENSTFTSSSDCIGHEYYYNNNN
LNFRISNNVFKCVKNVINIRNAENFAARIIGNKIMSGYITMDVINPLSVEISNNEHTSML
TSTFNYLVNLSLRNLYGVNDLTRNGVVKLENNVFKNVSRVSDSSILTLKCSSSGNINYYY
KNVIYVNNNMFIGNNVTGVVSTDCSGLASDRNVLNNPNSDYELKILDGIKKEWPAVIYFA
RNYWGNASNPSFRVLDELVDQTVVKAVIGPWFRDSDMTSLVAQTSTFDKGNSQIGGRMDG
NVVLTKDKSPYSVVDDIFVPSDKKLTIEPGVTLNFVYGGITVEGILSANGIENSKIQFTS
KGSNFNWKGIKFQKMFQDWLIKKDFNWWAVYINSAWYVVDLLEDSYKKQTADLMCRQAGY
KESASQTLFKCNTLSSVEQILVPPCINNSGMYQRATLHCPDSNSFSVQDCDIIFYKSSSS
FYNVTCIDRPPMQTEKYVRITAKSGKRLTVTSTDDVILDSQLKSDSDVFLQITPCLLGTV
SDCYSLMSLKKPGWKNSNGLVLDPKNNPRRLADFNKDASFVSTPPFNPSDSGHVSIKVLS
SSAPADNVVIKVNETSSSLSLSTIFEATSSSSQSAFSFKFEAWEGSTAARKKRATGTAGE
RSTLNHVRMFNPVLGISIQGQLPLLQNIEIYNSFSHSLQISGYATGNFTIENLLSLDSKG
SGLLFKLVDSPSDFQCFITNNTFVNTKEAAIKWTGQGSLVVDSCNFLQFQTYAVSMESSR
VESKLSKAIIKSSQFRSKMYTIVLEIYGSSITPYFYVSVENNDFVEVMFKEDYYNHYIMK
LSYLNANLENNKFLDCSCTYLIYLVSCYQLRVSGNSIINNSIAYELIFLYSTTSAIITDN
IFLNNKGRGRTIRYFNYYHSYTLTINNNSFYSPDLQWDVYIESNWDRLSGVSATVYNLKY
NKWMVTDWSSALQRIFCFYNNPNNFPVDIWPSTLVNNGSEKSVDVSIPDPNQYNEFFGGK
VGYSRVLSNNSIGFYTILHSIYVPPNVTLTLVGGVVLKFNDGVSLAVEGEIILNQVEVVG
VSSFVVLKANKMSLSNVKASNVLGEFKMLVGTENTISSAAVSSDVFTNFNPGTEVLKISN
CAFNQVYKMTIAKYNNNYPTNCSVKVSGTNFADTRLSISTSDFAGANIEIIRSSFSDELS
LSHYDGAAISLNLYNNDNNILLQENSFESLSSRSIQITRATNFQSKDKIVVQVLDSTFSN
SIDSSVVLWNIYGIEAKILRNKFTSNMADTTKNYNMASVSYMYDDYWGAIDQWPSVQSAI
SQNRFENNGGKCIFEIKTTLSDKEQYYLDLFNRTNSRFDVTSNVFLNNFPSEGVVCSSLP
ITTFSSNLLSNPLVRYDFVAKYKSGFSQNCTYNWWDSNILANVKARLKDTTVDPTVGRII
FEPFLNESKFSCLAVQSCSGNGMCVAPDVCQCNAGWTGLNCSKYSCSRVYDCLDKGVCVG
PNNCSCSPGWSGEDCSWADCRQQNNCSGKGICAGPNQCACASQYSGSDCSQCKTGLCDCT
DQNYAGLLCDQCAPKLSGPFCQPLVSLLNISPDSGPDAGETNIFISGNNLPNVATYKCKF
DGNLEVPGTWVSENKIACVSPKKSAGVVLLEVKINEIEGYLDSKFYFTYNPSCPVNSCGS
NAVPKRGACDMGRCTCFVPWSGDGCDQLGLPPEISPVKNLSLVEGQNFILQLTVDQGSSI
LRWVLILSPEQANLDENLGLLTWTRVPANTKSYNFKIECSNKYGKSVTSFSISVAPSYSL
VIDSLPKGPFLQPQPVTISGKIAWVDSKGNDNFNNSEIPLVLLIKSNYGLRKIPTTASSV
PLKSIFSINFQPFNFEVGLTEVDAVHPAMVGNTLTNVQQSWTVYGVNLFLNPASVSGYVD
KYQFKNFLTIHNNGLDPLTRLYLLMYTPPMELTLFSTSSQISCKWLPSTNTLIKNCSLAV
ILRSNESISLNANISADQGLSGSFPITFVTSEGLNKRVIFSYAFQPRNPAFELVPGVIES
SVPRGGVLIKQVQVTNVGARSATNVLPQFPSIPNLKFISFGTNATTLTSLSQLGLVLEPG
DVQGAVAIVSSETGATFQFRFTIVSTSYLNLTVKVEDEYTYFSDDKPLLAGAKVVLTSEY
SDFIATKFTDSTGMVTFVNILEDYYTLQTSADKHIPDSRVIFASQDQDVVSVFVQRNAKT
NSIDNDFNILVMNKQENTNCNSWAVKAVSLEDRYDITLEADFTTHVPIPVVTMEPNEIDL
DLLETGVLKSLQFKITNHGLISAKGFQITLPSIGDHPFLTLTMNNTDFGDIPANTTFYVV
AEVLTDDAKKQQYVGSSLAKRNINKRSIIGCLGISIRATYFYVCDTRRYVSVGVSIHNAV
ICTWNFFGFGWGWWIGGRFGVVGVSRVSCGCNSNYPELCWTIFSFVSRCISVYYQPNRMS
YGYHVMQCVRKVHSLKMCVKLIGGCQSGSGSGGSNGGGLGSGVGSGSGSGGGTGTGSGGE
TGSGSGGGTGTNVLSKEDLGPVLAKRSLAINEFYVLGITFLGDEAWLYLQEPPTQWWSEI
FEPAFSETSEGGSVVTAKEFDVILKSPLPSNATLEMVRKLVLRYNSSFADWDKGGNGSGD
GMINLGKVQSSENNLKAYENEAKKANKASISDWYNEAYDIFQRSEYSPEQGVCAKVRIQI
QQHVTLTRTGFEAELQLENGESSDLTNIKIVLEITIRGTGNTTNDAIYKFAIGQSKLEGI
TNASGNGVLLKGKKGIVTWLIIPYSSAAPTSDTQYNVGGTLHYTIGNESLTIPLFPDTIT
VKPDPRLFIDYFLEKYVYSDDPFTTNVVEPAVPFILGMIITNSGRGTATDLKITSSQPKI
IDNEKGLLVDFRIVGTRLAGQDISPSLSIQFGDISPMSAVSVQWIMTCSLSGTFSNFSAT
FQNTNPLGDSKLSLLEDVKFHELLHTVLIDNPKSDSIVDYLVVDPDITVDVIPNSVYDSS
NGTRPLNVSMCSTSSSGLVAFGTTLKLTVTCDKIGWSYLRALFPPTLNAQQTFTSVTNSN
GKYLDVRHNVWLQVISKKNYLQIFDYISAPGTHVYTLYTTRSNLHTPTFTPNNFSATILE
NLTPPQVLIAVNNATDEDNDVITYSLLPQDDLPFSIAPSTAQDIIGDEFLFTIKKGIISS
TRQLDREERDQYSIIVLATDSGNPPKSGSAVVFVIVTDANDNPPQISGLSELIIAEDVTP
SGAVILGNVLVNDKDALLNAVVTTTLLHPDNQDLLTYDKNDLTIKSTSSFANHVGVHSFS
FVVRDSGSPPLTTVANFTLKIVKSNKFKPSFNSTNYTFSVNETNFVGVVIGNVSAWDGDD
PNEKITFNMESSVSLNTVPFNVGIDTGLITNLLPLVSTSENTIIKFKVLAFDNGALPTGQ
FSNSVDVSVKIEDINDHYPMFSKPSYFIEVNESTPINTELILVPAYDLDFGLNSEIKNFS
ARILSPPNLNFNIYFILDADNTNKKLRIQNAAILAKRSIDTFVIELKVADSGVPSLESTS
NLTLSILEVNNCVPSFNSTETNITVFRKIPVNSLLFMFKADDCDLNPQLTYSMVPSQPSV
PQNFISLNKNSGSIHLITSLSSNLTIKQLKITVQAFDQLHVSSNNQFLNIFISDVNVLPP
VFKPKVYETTVYESLQVGTVLDVVLSCTDDDSLSLFYRIRAGNDDNVFSINVLTGQITLA
KSLNFEEKSSYSLTVTAYDDLDQSLALNDSATVQVNVQNVNEFPPAFLDQSGITLKWFSG
QLVPNLYKPKDDDNDKVTFTLMPSAESKYFSLDPLAGWLSVIKPVDQPLQTMIQIKATDN
DFGLHELNIEILRDFLQKSLDKNINLYSSS
Download sequence
Identical sequences T1FB11
XP_009023389.1.102002 jgi|Helro1|176894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]