SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|177182 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|177182
Domain Number 1 Region: 37-208
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.23e-20
Family Laminin G-like module 0.0011
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|177182
Domain Number - Region: 12-51
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00235
Family Laminin-type module 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|177182
Sequence length 523
Sequence
MQIERDPTTENMEAKDECPCKNGGTCANSPSSAEVLCNCTMTSLTGTLCDDDSLAYEFTP
KSIFMYLYPQNTKPNTFIDTVVFGLITSKMNVTFLSIRGDTSNDFTIFYLQNGSLNVEVS
LEKKESTVRSKSLLSDGSYHIVRYQRIGSSLSLQVDTKPKIFQNRSESHKPGLFRNQAMI
IAGHQLDPRFASTFSGIIAGLYVNGLLVFDPVNQNRSSAIGNVYLKNNFNRLNYSHDGSD
SSHWLTVTTRRPKKFTKPRQDELIKAKHDPSQCPVYDKHLLDSCNVDSYEDDDSFIRPTI
EINRMFETVSKLDFPEVTDVGFECTSVSCLTGQTSPNPLNYNPKPAIDGSIETSSNVPKK
YSDNTSLKELPLFGTVYKFDQLKNAHHDKHFHQQNNYHVRYNDKNNEYAIYDNFLNDTSY
RNYYLDNPDYVISSIFTNIILTVGISISFIILVLVLIYAIRKCSQTKVKENETLDQLVPE
LRYNPKTSSVVTSNVHVRHVPELSQSLLRDKPICENYVKEWFI
Download sequence
Identical sequences T1FBC0
XP_009023637.1.102002 jgi|Helro1|177182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]