SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|177183 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|177183
Domain Number 1 Region: 189-281
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000109
Family Laminin G-like module 0.015
Further Details:      
 
Domain Number 2 Region: 20-127
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000277
Family Laminin G-like module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|177183
Sequence length 304
Sequence
MNDHHLFPQPPSSHHHHHPQHLEHLPSHPAQQPYNKLHPIQFRTRPSYFTIRTTLPNDFS
IYFQIQRIKYIACCRQGCLCIQIQMKTTLKDGMMLYAMNNSDAFIFCLELFNSKLRYLYN
NHKIPAKQSQDTCTTITKYMYTYNNLRDLHNSNKIPVQQSQNTCTDTCTTITRYLYKMDN
VVHVLVDDLKPPLNVSDNDIHEVTIQRPRPHHNVLRVDTTTSISNHTNIPILPEVETESV
IYFGGIPGRMYGTIPEEVQSRDGYQGCMFSVDVVGDTWPSLKASIEIKEDFHEFVVERCG
GMFM
Download sequence
Identical sequences T1FBC1
XP_009023638.1.102002 jgi|Helro1|177183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]