SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|177722 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|177722
Domain Number - Region: 457-500
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00678
Family Merozoite surface protein 1 (MSP-1) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|177722
Sequence length 503
Sequence
MPKSNSMYAVGVEWCLLWCDKNKKYYAIKENMCFCSSELAAEDKLVQSNECFACLNGFLC
GGVFTFAVYERNEYAVVGCFKIVNIKHGISVSSEIGCVNECYNLMFKYVIRKKSNEKSCQ
CGNKIEFDSQIAMDSCFNDMFLVFDVSIDTDMYNKSTIYQYCLNDEKESFPGTTPTTQTL
AAFPGTTSTTQTLTQPTTKVYVNKCGENNGGCGDSVCIEVEPDNGAGVEANAGVKCYSPD
EEFIEVPEIKVQYNYTYKGCFEIMHANDNLATASLESCFDFCSDSLFYGMKDRKYCACAN
NLENEVSANKCNKNCTEGLSCGGKATYSVYASKKSSESIDVGCYKYLELEHKHDQFLSKT
LCLQKCKNFGFPYSGTTSDSCQCGRKIKFKDQVNIEKCRSSSSELVLLTDVSPDVNVYDK
PTKYNYCINDKVESKKPYCRSGVCSLGWTGALCDNRDCSTNNGGCNETMMCVPEIVNNLM
VVKCLCENGSTNVNGSFCQSEFI
Download sequence
Identical sequences T1FC47
jgi|Helro1|177722 XP_009024128.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]