SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|177745 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|177745
Domain Number - Region: 69-113
Classification Level Classification E-value
Superfamily Kelch motif 0.0392
Family Kelch motif 0.036
Further Details:      
 
Domain Number - Region: 28-60
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0963
Family Merozoite surface protein 1 (MSP-1) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|177745
Sequence length 241
Sequence
MDFKCDLIFNVIILIINAHLTRSVLARDCSSDNGGCLPDELCVKKLFRGEFIVKCLGPSS
EMVLNVQTAHSIYFISDLFYIVNGFNNNYKLSLFLFYNTFIGTDHYLANTNGKHLLGCFL
TGVTDTYDFNDKVLIYVDSIGECSYQCTTPYYGIKFINNKHQCECFLNIKYRTSMARCNQ
TCKDEPVSNLTLVGCFTSVTHHYKAEDKTVNVDTCAAACREKSFSFLGYKALAKNIINWN
K
Download sequence
Identical sequences T1FC64
XP_009024150.1.102002 jgi|Helro1|177745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]