SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|177746 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|177746
Domain Number - Region: 64-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000754
Family EGF-type module 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|177746
Sequence length 110
Sequence
MDHCTQLDSTNAIEVFSVLFERSFDEGTEEYHFCLNDVVESNESYCEQGVCVPGWQGTFC
DIRDCKIKNGGCGRNFKCFQIIVNNSPFMNCACERGYSSADNEECISTFS
Download sequence
Identical sequences T1FC65
jgi|Helro1|177746 XP_009024151.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]