SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|177765 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|177765
Domain Number - Region: 277-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0117
Family Merozoite surface protein 1 (MSP-1) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|177765
Sequence length 327
Sequence
MTWFKCSRSETRALQKNRVTTNSRVKPDDISNMEPTTKVYVNKCEENNGGCGDSVCVEVE
SDNEDARVECHPPDKKVIEVSETIDSTAMVYKNECGEFNGGCGDSVCIEVTPDNEADLNT
ISGVICNLPDEEVIEVPERQYVLRMCQQIGEREKTNRYVDLGCFKYLKLEHKQDQFLSKS
LCLNMCAELGFPYSGTSSNSCQCGRKIKFKDQVNIEQCTGSSSVYALLTDVSTDFGIYDK
STKYNFCMNDNSERKKPYCRSGVCLLGWTGALCNNRDCYTNNGGCNATMKCVQEIVNNEM
IEKCFCEDGFITVNGSFCKSYSVLSRF
Download sequence
Identical sequences T1FC78
jgi|Helro1|177765 XP_009024165.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]