SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|177819 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|177819
Domain Number 1 Region: 154-347
Classification Level Classification E-value
Superfamily vWA-like 2.23e-48
Family Integrin A (or I) domain 0.00046
Further Details:      
 
Domain Number 2 Region: 605-647
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000392
Family Antifungal peptide scarabaecin 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|177819
Sequence length 653
Sequence
MISLLEAFDETLTARASGPVVVEAVCRKIESACVFPDDKMMLRRIAYVETNDGLDGGTYA
PGNFGGIWKLTKSLSSALYSSIYGAFKIDWKTVSYSELSKPFYSGLAARIFLSLLSNNLP
RSVIDQAIFWSQNYRTNGHLSTYMNKVNNLNTGCKNGIADIVLAIDGSGSIGIFDFNVIK
SFLKNFTSSLNIGSDPSSHSRISVVQFSDHVQLEFDLDEHSTLHDYERAIDNINYLDMNT
HTHLALEYLTTKSFVPSAGARSAGVPKIAIVITDGASNFYNLTLDKAAELHQEDITVIAV
GVGASVNREELTAIATEPSCRNVFYLDGYFDLQELKDTIEKKTCEAPIYVSDTPLNFTLY
ANETRNCKLTVTKSGLTVEIVGGDGTVYFSNDTYPTSAFYEISVHITTFTPAVVYFPGFV
YSHERYVFCRIESHTNNKTIYEIETVNNKTDSCDPNPCRINQKCVPRKHFSYECVDEYGK
TKPTTTIYEFSRTPRTTRSTTFPELTRTRKTPPTVKPSTPFLGFTEIPTTAPPVLTAFIK
FSNTSRTVSRIMTTPSFEFTRPPKLTTTQTSAVSTLRKLTTTDHSVESSKYSCVKNNPCT
EENASKRKFYFPHDDPSKFVQCSQWGQCFEMSCPASLIWHATYNTCIRSRAMI
Download sequence
Identical sequences T1FCB6
XP_009024213.1.102002 jgi|Helro1|177819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]