SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|177898 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|177898
Domain Number - Region: 457-486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0167
Family Merozoite surface protein 1 (MSP-1) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|177898
Sequence length 705
Sequence
MKKGKECYCVDRVMFRVSSQLCNRKCKNGKDACGGGGTYHSVYSIKRCMLACLEMKALFA
YISGEKCQCDFTDKENCLASAGTMMTSSKISGMCDNCVVRYHASVDSVQLNQGLSSFRHC
ALLGATDGKKFKRDAEDRKNVKKKKRKSEDDGENDRGSERSLKYWGECEGVLVRALDGRV
GDVKLVLREAQMDAMWVVVDLEGQFIVERVVIYDASQMPVISVGLNKSLHVPPKKSFLSG
SYELCDSYHESRNCPENRVEMHCYDKTYAARYVIIMRDDDDDGENDEDEDEDEDGDGVGG
VGEINRSMVFSEIEGKTTCFCGTDADQMTSSQFCHMTCRHSNHLCGGDDYYAVYSGFIPR
AKQNHTQCACGSLLDFKDQLPINMCPLKSWSIYSIEPGTLMHFQLNRRDEKNVENSTKEM
NEEKKIKETNDGKNERINELGGLCFSGWSGPMCDVRDCKQNNGNCDLNSSCVKVKSDGDV
TVECQSHFGHVITKKKNAFEPTTKSTLLNTDQTDQSYHFLLHHKDAIILGFSLAAILVAV
VIMATVVVVSDRKKKKAEERRRKMIMWMVLRRRARKMTGAHYIHSYVAKVEVINKTQAWR
SFLAPQPMPTLNVSEFLLFLCWIIGDRFPRRMTPFQPDDPSISYRREQGLKAMAGFDYKG
QVSEVVVVVLSFCLPPAVGRASSATSSYPPVECSDSLVATDEMNE
Download sequence
Identical sequences T1FCG0
XP_009024310.1.102002 jgi|Helro1|177898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]