SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|178416 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|178416
Domain Number 1 Region: 12-125
Classification Level Classification E-value
Superfamily vWA-like 4.75e-19
Family Integrin A (or I) domain 0.0055
Further Details:      
 
Domain Number 2 Region: 1509-1553
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000167
Family EGF-type module 0.016
Further Details:      
 
Domain Number 3 Region: 1433-1473
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000699
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|178416
Sequence length 1674
Sequence
MEKMIFWFLIVTGKVNGLTAQGGPTNTSGALRLVRSDVLTPTAGSRSGVSKVVFLITDGE
SNIDSQYTIPDAYQLKLLGVKIISIAVTSDLNAEELQSIASAIQDVYYTNQYTYVSNLTD
VLAARYCLNAWGGGPGATGATGPQGSTGQSGIGLPGPQGPVGFTGSTVNFANRWVLRSAL
NFESDREVVRARIQGPPGPPGSNSGSGVKGDTGFPGVPGATGSPGKDGIPGGLGATGLKG
DPGSNGSPGYPGPVGPFGQPGFTGSTGPLGPPGAKGDTGLFGPIGFSGATGYPGSPGPSG
QPGPVGSTGVPGFNGPPGGLGATGFSGSPGSPGAPGQPGSPGNPGLVGATGFPGPKGDQG
PVGPLGATGYPGSPGPQGIPGAVGSTGIQGLPGPVGATGLFGPPGPQGGIGATGIVGMTG
STGIPGQPGATGFPGSNGRQGDTGFSGPPGYPGPQGSTGLPGAVGSPGSEGRPGSTGSPG
VGLPGPSGPPGATGVMGITGATGNPGPPGNQGSVGQPGPTGPSGSIGGTGASGVQGFTGN
TGSSGPLGPPGPSGQPGFQGPVGASGLPGRQGDTGITGATGFQGLQGFPGFTGATGTPGN
PGATGAAGNPGSAGATGFPGPLGPAGPIGPSGFNGFTGATGSPGPPGPMGSTGIMGFSGQ
PGSPGSQGLQGSPGATGSVGSPGNPGATGASGTPGLNGNPGNPGPIGPSGSTGFTGYPGN
PGSQGLPGFTGSTGQPGPAGSSGSQGFQGPPGAMGASGPVGASGLQGPMGPQGSPGATGI
KGDTGLQGFPGQNGSPGATGLPGPQGSQGPMGFSGSIGAPGPTGNPGPMGPIGPTGNTGS
KGDPGQQGAQGFPGPSGQPGSKGDTGSSGQSIVGPPGPTGPQGLPGPTGNAGGLGPVGFT
GSTGSPGPTGNPGSQGLPGATGPPGPSGMSGGRGDQGIIGPQGSTGFTGQSGVPGPKGDP
GAPGQPGPIGPLGIPGWTGSSGLPGPTGQIGPPGSMGPMGAPGNPGTNGNPGPVGATGSI
GPTGLTGSPGSPGLPGQIGNPGPTGNLGPVGFTGATGPLGRNGDPGSPGGQGSPGAVGAT
GPIGASGQPGIVGPSGQPGPQGQMGASGSPGPIGPIGPFGPPGNTGSSGQPGLPGSPGSP
GTSGIPGPMGLQGATGLPGFNGNPGQNGVTGATGPPGNSGQQGIPGNPGNKGDPGNVGPP
GATGSRGDTGFSGPAGRTGIKGETGFTGKTGATGVEGPTGRTGPKGDPGSRGMTGVPGGP
GSPGSPGQLGSMGYTGYTGITGPVGIPGPPGPTGGLGFTGGTGPVGATGLSGSPGPFGSP
GQRGDLGFTGFTGFTGYSGSPGFTGATGSPGSPGSKGDTGSLGLLGPPGQPGPPGQPGTP
GFNGNPGAQGLMGATGMPGPSGGPIGPPGLPGQPGPPGPPGENSGSSVIGALPNVDECLL
ADVRCQQLCYDAAHSYFCFCSAGFVIAPTINSCPNNMPITYCRYYSEAKGNICFCSNITS
TLPINSTLCQDDNECASDNGGCSQTCTNTLGSFTCSCKMGFYLSNNRKTCNAPGSIAPYS
IQLPFIGFDDNNNNNNNNNNDNNQKTWNVIFLASCSVNLLMTILTAVLTHRYFRKRFKSI
RDSDTDIDTESDNYSCGIDKSIGLDSDNTNCNTDRDGNKCKVNSLVEDEKNSLT
Download sequence
Identical sequences T1FD51
XP_009024759.1.102002 jgi|Helro1|178416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]