SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|178663 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|178663
Domain Number 1 Region: 9-63
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000458
Family B-box zinc-binding domain 0.005
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|178663
Domain Number - Region: 205-242,274-475
Classification Level Classification E-value
Superfamily NHL repeat 0.00262
Family NHL repeat 0.015
Further Details:      
 
Domain Number - Region: 57-121
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0497
Family Formin homology 2 domain (FH2 domain) 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|178663
Sequence length 502
Sequence
MEISDNHEQSRYNCPKHAVEVLYICKPCRQPICLHCHVNDHNTHELMLACLEASKNKRFL
EKYAQLAETEIKNVDENIERLIPYTENANSVFEEIQAYYSREMEKFENEEILKSLTSFRN
DRTKLKNIYIDCKIKRRNVNFLVENETRELDIQLTGKFERNIYHVNYQNMESNLASFRKI
LRNSIIITGLKDDFASLVDEISCGSLVTCFAISDYKLYICTGNKLLIINVIKRDEDFVEK
TYEGLENLPDILVYGNKFYFYLSKNTTDVLTPKYPEFKKVKNISCFSLSGDTIIAARQTN
VLDVEIESWKLICIQNSTKSNKVEFTTNDYEDSEFTPNDDEYILSVVKLRNKNYVIATQN
GLEIFSRSWDRCITWDSIKNLNGHEPLTSQHNHSATMCEYETNMTATAYLSLDSYDNIYL
ISNHIVENIFVLDNKFNFLAYIKTKFVPKKIQITKDNTLYVSYLNEPHISIYKLNIFERS
DNTKSDVQADQTEQKEKETVQD
Download sequence
Identical sequences T1FDI9
XP_009025004.1.102002 jgi|Helro1|178663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]