SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|178717 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|178717
Domain Number 1 Region: 254-487
Classification Level Classification E-value
Superfamily Kelch motif 2.88e-36
Family Kelch motif 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|178717
Sequence length 563
Sequence
MLLRASGYYQGLVNSGMKDVHYRELTLACLTNESLIEVRDYLSRLSTNVLESVKSLNEVE
AGLDGAFYLQINDMINSYIELLLKNLNKSACIRILDIANKYVLNNKVVEKVIKFMLKYFK
EIPESCKISLSPDEMFCLVASEEMNADSEMDIFNLIIKWVSEDPSRKCFAEKLLTEVRYN
LMTTSDKQKCTDTILDLNLNISYDTDKDSNISRTGQKRSFVDILPVYDFVEACKFSGDNS
GPSPVKFNPSRRSRPPCNVTRTACVVDNCLYLFEKWTNDGSFSGRIFMYNPIAAVWSKCC
SMHQTKVDFYFGGLAGNLFAVAGCLANYDIAVGLTPAVEQYVPSENRWYMAEPLPHAVAN
LAGCVWNGTMFVSGGRDPWTRCLVYQYDPLCNKWFAKAPMLTARTDHVMTCTGNKIFAVG
GFVEADDDYPDEVEFIWPNGGDSRDGEMYDVETDQWTSVFNLWRPAFHTPSITINNCLYI
FGRNRYRNLQKINLAKYTKEKKTSNDSNSSSVQDRNADNNNFVVIDAEEQNSHTHDCQIF
KFNRQKKGRFKYHYVGVMFVSNI
Download sequence
Identical sequences T1FDM3
jgi|Helro1|178717 XP_009025047.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]