SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|178722 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|178722
Domain Number 1 Region: 111-220
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-18
Family Scavenger receptor cysteine-rich (SRCR) domain 0.002
Further Details:      
 
Domain Number 2 Region: 1032-1108
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000719
Family Scavenger receptor cysteine-rich (SRCR) domain 0.011
Further Details:      
 
Domain Number 3 Region: 71-110,220-379
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000454
Family Galacturonase 0.045
Further Details:      
 
Domain Number 4 Region: 484-768
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000136
Family Galacturonase 0.059
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|178722
Domain Number - Region: 890-954,1111-1216
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000628
Family Galacturonase 0.047
Further Details:      
 
Domain Number - Region: 393-469
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00617
Family Spermadhesin, CUB domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|178722
Sequence length 1282
Sequence
MVFQPFTSNRQRRITKVPWKMSPESRTHYGEISSTENQVTIGKLDSPCEIKKDLTIMEEA
TLTLKPGSRLVFRPSVTLGINGTLIAQGTPDERIVFTKSSLENLNQPRWPDDIRLVEDFS
VHLGRLELLFNGKWRGVCANFVNWTQADVDVACRQLGFETGTFAFLPWTYNHTLYMLYHA
PSCAGKESSVKQCPGYSKVKIGFDICHHQRTIHLRCKGLSPHNPAKNEFWSGIEFYNTTT
RKVINGHISTNESTSVLQFVDILYAGSGKDGNAIPSLRADPHVPHLYNVRILHSALDAIN
FTNVHSTTVVHNSTFENNRGWLLQFGHGIAIESHLGHVTLTDNIFTSNYGNGVKVKFLSG
RYVIYDKEATFCDLSHLRLQTFPLVIHGIPNFSYECLKRFTTVVGERLTMNVLEMDIEPG
YQGKLVVHDGSDQTYPILGSYDIINGTLPMGVTSTYDNIFIKFTWSPRFSRSCETLKTCI
KFTIVIDSAVASAPEFFMNNTLVTNNMQHGLFIENLRNYVIVNASNITHNRYGAGVRVYG
GAGDVLINSSLVAYNMDNGVNITVEGGWRIFNRSSFNFNLGNGVNITFNETNIDNKTRYA
RHQRTEVSFSTFVGNIGHGLSVANFCRSALHVVNDSFFLDNHKNGIEFLTCYNNIPLQNM
TNITIGYNIFQGNKDHAIRMSPMLNAVGRIANNTFKQHKKRVLLIDNSDDFRRLMFLQGM
AVDYEVEGNNFLQNSGQYVAFLRLSQGSLLQKLIFRYNFLEDNVIKSGLEGLNERIRSHA
VLVVSSDNVVLKRNHLINRESTYELSTHLLEMNANIQASEQWWGTTNYSYVIERIFDQAF
RFNLARILYHPSLEYAWLYGPVLTDRNIEIEVEFVRGSKLGGRLTREFTTSPGHTYYVDR
DISVKPFGKLIVKPGTVFEFENSLGLLIQGQVEFDGSAENPIVMKLKNESLAHTASTFDG
FSEDDGCKFAGMNLMPGPLSAMRFFPRNLYALEFRNMEEILNFFMQNVLNDFEHPICGKE
IFSNERKKNNFQGWTMRDAAVACNMMGFVIRPDDWKVKVVKPKTSSLNLDIRLSHVSCGD
LDVNLLACESQTEHSCDHTQDVYVRCHHPAWSGVRFLGSASSSRMSHVVIEGAGLNDPSV
PVYVPALKIDYNVHALNHLSIRNNAHDGLQIMKNDAYGGCHLRSSAVSSNQGVGLSVRDS
FFEVSNCVIKNNSKEGLEYNPTMTSYEALQVRAGVHKYITLNETRSIMLKDHEVIWVMTK
RQYTKEIKSFMIEFMVTQHFRV
Download sequence
Identical sequences T1FDM8
jgi|Helro1|178722 XP_009025052.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]