SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|179428 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|179428
Domain Number 1 Region: 84-138
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000119
Family B-box zinc-binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 5-54
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000542
Family RING finger domain, C3HC4 0.049
Further Details:      
 
Domain Number 3 Region: 326-483
Classification Level Classification E-value
Superfamily NHL repeat 0.00000288
Family NHL repeat 0.03
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|179428
Domain Number - Region: 134-184
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.0016
Family Coronavirus S2 glycoprotein 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|179428
Sequence length 558
Sequence
MKREIWICPICKNFLDRPKMFKCCRHTFCYRCLERFYSDRQEQETITCPNEKCNNQESIL
KKNVRDLPDNLFLKKLVELKTIRPRCLRHDDYLRAFCINCKQLACHTCSMVEHSKHQFVE
IFEAADNMKYELTDAISKKKLSLDKVNDKLNKINQGLEIFNTKFKSIQDAIKQSGEDLKK
LIDERVADLITESESIKTENLNQINPVKDTFMKHKRNMEAFICDSNELLNRGTSYMILNN
VPKLLCESQSIEVPDYNQFVVNFGIKFSHKLVQKEDLIGSIRKQSDNSQEKIADKSQIIQ
GKPILLEGIPGTMIVKSCFIYFSSLYCGLFSSNEILVYHLNNLKQLKFVIEVGGLRDPQS
IVATCNNLFISESLQSTTTVYKIDLFNYKSTKWTYSSTYSKLSVTEEDNLLMTCMNPNVL
LEISLLGETLKEIQLDSSLDEPRHAIKIDENEYVVCHQGEKHRVCLIDSSGSSVNIVGGC
SNSVFQSPNHLIKISKNDILIIDSSNVRTLSVDMKILKISRELKFDQPYESNVFGTLNVD
KDRMIIISNNNFIMYFFS
Download sequence
Identical sequences T1FEP3
XP_009026520.1.102002 jgi|Helro1|179428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]