SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|179547 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|179547
Domain Number 1 Region: 73-237
Classification Level Classification E-value
Superfamily vWA-like 8.75e-28
Family Integrin A (or I) domain 0.0036
Further Details:      
 
Domain Number 2 Region: 248-361
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000103
Family Integrin A (or I) domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|179547
Sequence length 373
Sequence
MYYVYKIHVSSVFCLSTGFPQGSVLGPMLFTLFKCQHGHQSTHLNAILKNHLTGLGTLNN
LGFTSFNAYSNPALQFVQSVVSNLSSQTSDMRYGFIRFESIAEEMFSLDTYNNNTAATLN
AIHKIDYPYDRDTNISGAIWKMHDMFTRKARKGVTKVGIFISDGESKIDGQYVAQYAREA
REDKITIIVIAITGLWLQLDELKLIASEHKHKQLLHNITTYSELNSQLEEIVADTCQATE
DSTPKSFCEENKDILFLIDGSIISYQDVLKVKLFLKSFSLGVSLKSSRIGVIVYSNVVEY
KIPLNIFNSSTTFSDMVDTITVQNNQRADLAEALKTAGKILNLDYRQRIVIIITNRGSSE
EKAAIENAVLVIN
Download sequence
Identical sequences T1FEV1
jgi|Helro1|179547 XP_009026626.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]