SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|179612 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|179612
Domain Number - Region: 639-663
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0307
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|179612
Sequence length 953
Sequence
MCVEDDIHVEFTNHAWVNFLKYKADDARLEKCKTSIISWLRDLKAVEQKLGINLRHLASH
GGEENDGGASELIMQPDQLEFLSNEWKCPDNLTLVNETELLSCRAERTEKSSNWTWSNKN
KISTRVTVFENSNRQTNNNMKNPAASQPVKIMHWSITPPRNISQVHITEADRTIKLTMRV
FVNQSDVCSRRLRHKCPTITIDVHFANDHAADDAATTATTTDTAADRSSNSRSSSSSISS
GGGSRGGEGEGERNVRKPNYCQRSEKPIPSLLLGEVLLNNRAVFNGTCSVRVLNISEYLN
EENEQFEISLYLKAMMNHRTYNNFQEGEFVLYRHVKLPFKVHVIYQRCSKFVAATCNCGV
AVQSGDDILVIEKWALIYLPHGTYVKTMLNGPMLNVWVVPSPRDLYNTEGLCGQYDWSTG
RNFRLKNGTIITYEHLHNGDDDDDGGDHGDNINNNDYDNGDDDEEEEDKDGGGFRIEPDE
FIESWRVNMKSSESIFYGTNPTTKNYQPPKFCACMQQQQHQQQKQFDYENKCSQTIDVDH
CDKWEWTKNWTRKAATKFCQNFMRGNYSVGKLCGHILSVDFKREIETCVEDIKITGSTDW
ATSARDAMKEQCLEEVQKDVFLSREIVRKIKSQVCINDCSYHGICVRGMCVCDNGFSTAD
CSVVYPSRPQILESKNLGQCDVRTMNCSRMILYGRNFINNPNLTCHLQEYKMTNDNPMLV
GRRDKRKAIFISTYAAECPLPEVKSYLISVSNDGEHDSDPLLFMPYDSVCNRCDIHKLSC
RKKHNSCIIDGMCYKVGEDRQQTINRSKSSTCSDHSKRSSSSIDDYDDHDIGYPSEDSFN
FYDEFSDRLVHPNSNALLHRNQLLSSSTTNTNNTVTTNVTSSTKHASSNTTVKSDNFTNN
DDDCSNSISRHKAKLQSPEESFINFGIKRILPSQDFINPGQSTSNDFDSSNYF
Download sequence
Identical sequences T1FEX8
jgi|Helro1|179612 XP_009026671.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]