SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|179733 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|179733
Domain Number 1 Region: 149-228
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000288
Family Spermadhesin, CUB domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|179733
Sequence length 609
Sequence
MAGKSRIVTRPPSFSMPLKLEPSVHSNVCEAEDFEASCASDDDVVVIEDALLGMMEMTTK
CVVADYGARGCSGDATTRLDYFCSAQRQACDSCQSPTSNHAHISGSQSGYITSSVTIDNR
FGLSNKFELNKFDPIKFDPIKYDLVRCGGKSCPWRIEVNSGQTINLTLYDFGVAYFSMHH
NKSNECYIYGQISEPSVLRSHKICGGRSKVSVIYNSVSNVVDVINTLTNSSLGQYVIYYE
ANGCSDYVPPDRGWAKRYNDRIVVGCNSSTSLHWEVTCVNRKQQRELMYPSSGPIISHYL
THEPHYDIDLDPKTIATLNTIQRKKHQQQQLLLQQQQQLTLDKKLNKKNLKIQQQQQKKR
HKSSRSLSDGSRNVYARTKMEFRPLPSIPVSQGNRPIENTMEDYPYPISASIPSLPPSGG
NLSSAECEQQIVHMPPTPGFNTASRKPAKPMRTSSNVKPLSSSSSAAVATSAATTPSTPQ
HQQQHSLPIIQQQQLHHPQPPKQPLPPAPTQHYTMLDPIEVQQLIARLPQQQQQQIYPQY
HPLQLFSQPPPLQPSQPPQSTSPPPQQQHLQFPPPPPPLNEQGVALRPCREGSQQILNDS
SQNGTSSWP
Download sequence
Identical sequences T1FF33
XP_009026785.1.102002 jgi|Helro1|179733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]