SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|179784 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|179784
Domain Number 1 Region: 442-673
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 4.51e-23
Family Serum paraoxonase/arylesterase 1, PON1 0.066
Further Details:      
 
Domain Number 2 Region: 53-105
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000825
Family RING finger domain, C3HC4 0.0065
Further Details:      
 
Domain Number 3 Region: 193-251
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000244
Family B-box zinc-binding domain 0.0024
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|179784
Domain Number - Region: 239-369
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.085
Family Apolipoprotein A-I 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|179784
Sequence length 686
Sequence
MSSRNGPKSARSTKNRQPEETNITVTTNNTKNNVDKNNHDDDGDDDDTDDFLHCPCCQNE
YNQPKMLPCLHSFCYECLESNLTQNGIGPGEAFLCPICKTQCVVPARGVRAMKSNIFLVT
LQEFFHSKTLDPETECEACDSGRAARKKCIECSDWLCNQCCAMHLKVKMTKDHHLVSPSE
LESGQYDQLIKESFEPLLCSKHNEPLKLYCRDLSCQAPICTVCKTTPAHEQHDAIELTEQ
AKQEAGYIKSLMPATRAFITTTAEKITTLEIEEKSTIQIRKKLHKAINDRTQEVVERVVR
RIQHYAESVLLKVEEMSKEHRKDLVAESEACRNKLQAAVSARSFAEALLSFDRPEELVSM
SREVRSRLEDFQTPVDPMPPAWKEPRLNPAAAMVDGNDEGDDDQLVARLFGELTFEGEAM
SRSVPVAARAFSARWTHDEKECALCDVTLDAAGNIIVVDKDNRRIKVFDSEGRLKMLSDE
AAELKSPNRVLWLRNSGQILVKDEKYLKLFGQDGRFVGLLTEKLKQPVGLAQNEAGDILV
TEWMAGEVVTLDQEGKRMKSFPVLCEAAGYITCCPNGNIVVSDWKQHVIKIFDANGRFLK
QYGGQGSGDNQLDHPYGVCSDRFSHIIVSDTWNNRVVLLSEDGRYIKTIVGKMDGIEWPQ
AVAVDKYGRLLVVEQHGLVKFFQYLA
Download sequence
Identical sequences T1FF55
jgi|Helro1|179784 XP_009026823.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]