SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|179908 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|179908
Domain Number - Region: 188-230
Classification Level Classification E-value
Superfamily Kelch motif 0.0497
Family Kelch motif 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|179908
Sequence length 1267
Sequence
MDDDQLEKSNKALTLAQVALNPCINKRLYFKNLVSTLREPLNPKIVRKRKVAGLDCDLSE
EEFIEKRKKWQSKKLVTGKDYDPDTDYIYDARKYYDPEKEQEAIEYRNKREAFLKMKQQK
QEELQQQQQIQPPYLATNFKTQSDFFLASKPYLRNQGFAYRGGRFRGVHPFGGRFKRQRG
FMPQMMGYYAGGRDGSYQNYESPYPAGLEYNSSNDAWLCGGDMNEPRCYSDVGGGENEDG
VGYHRVGSSYRQDVPDEDGGGGGGSGGGGSRERKKKVKKLSKKKSKKKHHHRKSDSKKRY
NSDDGDDYDDGDDGRDPLLRGEDDVTDDADEDDEEEINLRQLRRELERKKLQLKQIFLKN
SHSDGGGEENEDERALKSNDPDLSTSSQHHHPRRHLHRKSPSELHTRSNSSDSYGTPETS
PSEQRPADHKSASSDYKKHRHKPSKSPSLISSSSSSSRKSSAAAAAVPVEVDEKHASGWR
LASSRDKMRKRKRKMTQKDKKMARNSSTNNNSFSEISSDDGRSSCERANRRNFNENKLNP
PLADDNNDDEKCDDDDGNGGDAKNADDDDDEIKLLNEGKKLAEVIKRTEELLYGLGNCTS
FTKIKQYARSYFLKTNIDEQLKVFLSRHIERSCSEVAYHSSSYIESQAASASSAARSKDD
IDVGTLENPHHQRHSGRPGGNFTKKYKINQVIKSRSGQNSNSSSRKSSPDVRKSRSHRRS
RDTSQSNGSSIHSDDEDDDDEEDDDQSKHETSHKSTAKKSTSTPYATDDVKRKRKTQQQQ
QQQSSADQSESSSSDESNSKNYHPPQRKENHSRTLNKYINDHATGRKFENLQIRVTNSAL
MQASKTNNNNNGNTRYNNNNSFCYGDAGDQVNKPPPITRPHLLPDPAPYYLRGGGGGSGS
FVGSGRSSNDGFYKFNDKVLEYEIGNNNSGERYFNPYRGAYYDGRRKFERADAIVSFKNS
NYKNAIYEGNEFELADDEQHFSSSYKLLGRHNSSTFYADVECDHADHYKQHYRAATSSRE
HRKERTPTDHYPTSHRNYKNYSLTTTTTTYPTSNEKNKLETLLSKNSMVADQLSPPPSSA
TNCSGSSSRKSIYERLGRKLGDDVSWNSRRPQVMKMPGPTNNATSSTFITPEYQNKYRTT
RDEPLLPQFSRNLNRHDNLMRRYETYQQHQHVQHRPNFKPYITNYAASSGFGAGSSRSSS
SSNQPTKKFIHPLVHSSSSSFASSSSHFKRNLLSSSSSSPTTSSLASSVRLPKASKSLQS
AVSLVKR
Download sequence
Identical sequences T1FF88
XP_009026936.1.102002 jgi|Helro1|179908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]