SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|180027 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|180027
Domain Number 1 Region: 310-517
Classification Level Classification E-value
Superfamily Kelch motif 1.57e-42
Family Kelch motif 0.00027
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|180027
Domain Number - Region: 26-125
Classification Level Classification E-value
Superfamily POZ domain 0.0118
Family BTB/POZ domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|180027
Sequence length 729
Sequence
MEMKMNNMEKDEAADDSRTIVFISKTGGRFEVSRASLLQTSDYYQALVKSGMRDARFSDL
ALEFLSDDSLQEVREFLLSPRCSEEENEKCSRIIKRLTDIKRGLEGASYLQINDMKTLYL
KYLLRYFNETSYVRLMKFAKKYASVEDMEMIYDSLMMNFRNIAKHPKIMPYNVLFRLVKS
ELVNADSDFDILKIIIDWISAKESRRSYAEKLLKNVRFDLMCTEEKQKSAEAIKKMELDV
PLTERTSNCHRGVGRLFALVNNNTDGFNSECYSVSLFDFVRTCDSRKSTTPPVVKFNHID
RYGPRDYYEQCTYHLVNYRLYMVGGERYYYMKKRTLFYDLKSCKWGRLADMGVARSNFFL
GNIGKYLYAVAGFCCHGEVERFNPDKNRWSWLAPLPIAVSGLAGCVHNGMIYVSGGYRYG
DEFRNENRVWQYDPAFDVWSEKCPMLSRRRGHVMAFVGDVLLVVGGGLRKSLMNGEMYDF
ATDQWTYVLKLKMPVLESPSILFNNCLYIFTKRSYGKPKNLYIQKINLKKYLNNTNTDDI
NITDDYVYNINDEDDEEEVDDEEEDDENIDIYDMNDNYDDNASDTTDENYEEEEEEYIED
NGSVEDNNEEDDVVVDDAYDVVVDDAYDVVADENNVENSVIHVVDRVSIAVDEDFVDHFP
IQETGNVVHNDDFILPDIKVDDDIINDYDDVNVDLINDDDDLCQIYKFNAGKKLSTINWI
GMVNMSTDL
Download sequence
Identical sequences T1FFD1
jgi|Helro1|180027 XP_009027040.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]