SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|180048 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|180048
Domain Number 1 Region: 57-240
Classification Level Classification E-value
Superfamily Kelch motif 1.44e-25
Family Kelch motif 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|180048
Sequence length 344
Sequence
MRRDLIRNGPPYHNKKYDESYSMSVYDFVETCKNRDSKKFEFNASDKRGPPSGYKVGMFC
YLNNRLYMAGEGKRTFAYDLTSSQWLRLYDMNVARSKFYFGEMNGHLYAVAVMCNHFLCC
SCNGMINVSGGCNIPNGYEAEKRMWQYDPASNRWAEKPLMLSSRRFGHDMVSFRDVPFVF
GDLDSKKNSMSLEMYDCATGQWSYVIKMKKPVKESLNFIIKNCLFIFNKRSNLFQKINLS
KCLNNRKSSSPNASHALPANDDDWADDDVANNEPRKLMSGGIDNDDEGGNVDGENDDTDN
NFNDNDVFGTTDDDDVCEVCTYTTGYNVLKEPYWLGIVNIPADA
Download sequence
Identical sequences T1FFE3
XP_009027059.1.102002 jgi|Helro1|180048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]