SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|180444 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|180444
Domain Number - Region: 30-76
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family Merozoite surface protein 1 (MSP-1) 0.046
Further Details:      
 
Domain Number - Region: 155-181
Classification Level Classification E-value
Superfamily An insect antifreeze protein 0.0811
Family An insect antifreeze protein 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|180444
Sequence length 208
Sequence
MSRCIGANYKIVKCVKCDIEWKGETCQDRDCSKKNGACGKDKKCIESFVNNKKYTECVCP
TGTVRNNYDDCQASSSITNFVVRLNETFDTSADYDIRKKVKHCGRWGATVYGPWKPMEVV
CVNFTLISRFVIIQQSDENFHLGDVASMEVEVYSADCYINNGNCGEMRCTEVLYDNVSVI
KCEDFKKEIFIPAPEQLKILLVNAAAEI
Download sequence
Identical sequences T1FFX2
jgi|Helro1|180444 XP_009027984.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]