SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|180469 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|180469
Domain Number 1 Region: 81-253
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-17
Family Laminin G-like module 0.0067
Further Details:      
 
Domain Number 2 Region: 266-324,356-403
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000121
Family Laminin G-like module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|180469
Sequence length 752
Sequence
MTPLKTTSALIDNSWQVIIISVSQSDLCVQLGHVKRKRKNWVKSQKREDGMNECVKMRER
SFWMSLIDGWKESVIITIEVSSSVTMLGDGWITFRAYDPDIVSRSFEWLAPTFKRVSILF
KTKSAEGILLHSLSSLPLVSYLAVSLFGASVHVSMLFAEKFEYDEIQDLVFTGPYDDDRW
HNFTLTKIAPTAYRIHVDDVTKMMTSSSSLDHVIILPPFIHLGGIDRESGYMGLKSALNF
VGCLNDVTINDYDVLTYLWSVNDDDDDLALLGEKLMLTARDKDSIVTKHSLGGKISDGFW
HTIKLKLLANKIKLKLDNSTRSFIHGKTQNGGTKGSSRRQENDTMDDVIIDNINYDNKVD
HTSANLCFLGSSPDDKNTVSFRGHINDVSIQGHTYDKINVVLSQSESGILLGHCEERFDW
PCDESDVPYHVFEGDVTNINDGKIKGSNGNRNNEDADEIERGQDETISSSLLLPSPSSPS
LSQSSSSSSSAANFSISNKTKSGTHIKQQHITQKITENLLPFTLPSKKPSTVVGIAATIF
TSVIIVSILVASISIKIVLLRRKNIQRYKNLSKRIPHIPMTSAIGQDNFTYDNSSNDDED
DDNDDGDHVYLHAGFRRYNSKVLYNHLSDVIVNNINNNNNKNNNNNINKNMLPNNEELNN
DTVFSRGFVQIKSARYNTTKRNNSKNNNNNININNNNNSSNKTNNDNKNIINTINNKSNL
NKNHTANGSSVNWTNQRNRKNESARSAKQQKQ
Download sequence
Identical sequences T1FFY8
XP_009028031.1.102002 jgi|Helro1|180469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]