SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|180474 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|180474
Domain Number - Region: 79-123,150-182
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00144
Family Spermadhesin, CUB domain 0.012
Further Details:      
 
Domain Number - Region: 215-265
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0134
Family Complement control module/SCR domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|180474
Sequence length 310
Sequence
MRTVIHLNDYMSTHLSSSSSSSSSSSKIIQAFLTSTPRTTTTKTPLHADNAKQQRTQKIK
LFLSSAISEQTGCGLSENPWVLMAGPGQRINITVIDFSQESLQLPEPMDNKRVYSSQNPT
YKQMDKSRNRTSEFTCRVLANIRESSFDGISTVCSGQGKVVNVKTSTSNKVELRFHGNRV
LSDGSGSGSVGAGGIAKPAVRLHSHFLFQIEVLGCATPTYPAPMTAKRIGDLLMVECNKG
GASSGGTGWTLTCINDVWIGNHGNCSHASSTISEKLENLFPYATSVVTIGVIAVFMIYAR
RYTKKISHSI
Download sequence
Identical sequences T1FFZ2
jgi|Helro1|180474 XP_009028036.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]