SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|180677 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|180677
Domain Number 1 Region: 1525-1780
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-43
Family YWTD domain 0.0000088
Further Details:      
 
Domain Number 2 Region: 649-904
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-28
Family YWTD domain 0.00046
Further Details:      
 
Domain Number 3 Region: 353-564
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000000000249
Family YWTD domain 0.00046
Further Details:      
 
Domain Number 4 Region: 318-352,608-644,923-971
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000243
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 5 Region: 1958-1997
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000864
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 6 Region: 2531-2689
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000314
Family YWTD domain 0.0019
Further Details:      
 
Domain Number 7 Region: 2096-2133
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 8 Region: 1104-1143
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000055
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 9 Region: 1838-1873
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000772
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 10 Region: 2055-2095
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000367
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 11 Region: 2225-2262
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000432
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 12 Region: 2174-2218
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000615
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 13 Region: 1154-1192
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000131
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 14 Region: 1920-1960
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 15 Region: 981-1013
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 16 Region: 1057-1093
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 17 Region: 2261-2301
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000288
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 18 Region: 2306-2354
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000314
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 19 Region: 2003-2042
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000367
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 20 Region: 1015-1052
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000458
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 21 Region: 1287-1324
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000537
Family LDL receptor-like module 0.0035
Further Details:      
 
Domain Number 22 Region: 1878-1922
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000838
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 23 Region: 2841-2877
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000936
Family EGF-type module 0.031
Further Details:      
 
Domain Number 24 Region: 1242-1279
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000113
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 25 Region: 2705-2744
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000035
Family EGF-type module 0.028
Further Details:      
 
Domain Number 26 Region: 1475-1519
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000986
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|180677
Domain Number - Region: 3063-3095
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family EGF-type module 0.047
Further Details:      
 
Domain Number - Region: 1205-1235
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000942
Family LDL receptor-like module 0.0034
Further Details:      
 
Domain Number - Region: 2827-2975
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.008
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 80-268
Classification Level Classification E-value
Superfamily NHL repeat 0.011
Family NHL repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|180677
Sequence length 3128
Sequence
MVDRKLCGFNAVCLLTLDGKHACKCPHLMQMDANDNCTYSPKLLLILHSQQLRGVYPDNV
HQNALTTILQPLPNHIFTDVDFDGLSKKLFLSSSGHNVTCVARHPNRDVMFTCVIEKTPS
GQIQGQIIMSKVNGSLKRVLPIPGEYVGNPHSLVILSPVTIAWIDRVRNEVFVLRDINPN
REYRIDGLTGGYESQGGSLNNSDVVAGLSYDQRSKFLWWFINHPTNQSTIFNQRIGDEPS
YSPTKFDFDRPFHTIQSLLADGDDLYVVEKRSNATLLILVNVSARNGTVLIKNMTSPVVK
MKMFLLRSESDAEMPGCCNHHCISSFSSGRHDVDDCVCANGFGRDTHQNMLIYSTGFSIK
VISFDNLSKVGIREKLLWMDNSRKQISSMHVSGAHLERVVGLGGVNGELTGSEFIAADWV
TGNLYWTDSTNNCIYVMKQQAEQQQHIYKRLLLSNLNQPFKIQVDPINGFLYWMEAKSRS
NKDQSRLFRSRLDGSNISVVQNFFQPQQHFVHNLYTDTLYWRQNQSLFSAFDVGRRSVKP
IPIPGATNSWTVLNSTIFWAANGSIMMRTSSLRSNVSEFVDGIDSSVIHIIAVNNKDTDA
LLARSSNPCKHKNGNCEQFCLYDGHRAVCSCSFNYLAVGNFCKERTESLIFSTGKTIKMI
PLYENDESLPLTQYEAATAGSRISSLAYDHKRKAVYYADVRQEFIAVLSTNSSEAVRKNL
TTGTGLINGMTFDPVNDNLYWTTDTDIFVLSLTPSSSSNEQTFKMKNKAGKVGVRNVRVH
QGLPEDRFTSIDIDYCSETGTIYWINANPERPSIDKVNINGSEFKHLIVTSIVSPIALTL
DRVGRKLYWADDSFYKIEEYSIHGGFREILYHHVTSIRSMVVHNDVIYYSDVNNQKIISF
NLVDRINKILNYDKLNNLGGIAVVRDYSTQCVSPCNKKNACQHICSDANGTAVCSCYPGY
QINPDNESCSWKLGLCDRGGSLFRCGNEKCVYSKMRCDGKDDCGDGSDEYFCHLCHDGES
FKCFHSEKCITVKQTCDGKRDCDDGSDEMKCPPLVNICLLPSFSCNHTTACVGVSQLCDG
VNDCWDGEDEENCDSNRTTASSIVCGSSSFRCHNNLQCVRQSALCDAWPDCDDWSDELNC
HPVPALNVTSSAGSRCPPNMHQCNDGSCLHEESWCDLKKDCVDGSDEDDAFCLTADSTRE
CPMQSNRKCGDGRQCLAGHLFCDDHVHCRDGTDEHLGCGSPDCSLVEVRCEGSTKCVHLS
KLCDGKIDCPNAYDESREVCRAKPIGECLEGQLLCKPSQECVAAHKICDGIIDCRDRMDE
NEELCRKKNSKCHPFREFVCNKTAASAAAASASNRKSNNDNNSKSSNKNDNNNNSNNGGS
SSSSGINKSINTGFPEYVSDMRRVSDVDVRCVNKRDYCLNYTADCGDGLDTERKKMCFVP
TCETNNCNGLCVQDVIGHHCECYGSLEHESKAARMCTDYNGCEDRFCSHFCRRSHANHFI
CSCAPNYTLQPDQTSCHANSSIEPMILASHKVSIHLKSINAASDRIILDNLVNAIALDYD
WSEQFVYWSDISTQGSNISRIRVNGTGRTLLHSSTLRSPDGLAVDWIGRNLYWCDKLKDT
IEVSKLDGRYRKILVREGLEEPRAIVLHPFKGLLFYTDWGDDAHIGRMGMDGTNRKNIIG
SDVLGWPNALVVDFIGDRLWWADAKLDYIAMSYLDGSHIVYLTKDQLPHVFSMSSFDDFM
YWSDWEHMTIQRTHKFVGGLKEVLYSTQHKPMSIQIFHPMNKPESIHPRYLNPCDPSSGA
PQCPPGSLCLLKYGGTERVCACSERHYMAQDMSACIANCTNSEFMCEGTYKCIPKWWRCD
GVDDCGDNSDEPDDGTCPPYHCKYPGMFQCHNASSPYDCLLANLICDGERQCRDGSDELN
CTAHSCMDTQFKCRDRCIPLPFRCDGKNNCPDGEDEVDCPVTTCADNTYRCNNSHCIPFV
WKCDGDDDCGDGSDETEACKVESCIKNYRKCSVSGRCIPENWWCDGDNDCGEEDGSDEKE
CPTPTSPPPMNETTTTLKCDDNEFRCANTEKCLPAYVKCDGMNDCSDWSDEGGCVPPCSR
GMFQCRTRQQCVPQKKKCDGWKDCSDGSDEMECNREFKCYYRDDERDYDYDVVYPDDDDD
DISDDGGNGVRRFDRFDHFRCNATAATTATTSATCILKMYVCDGWPDCTDGSDEVNCTHA
SYPNCSAAHGRQCRDGQCIPKLWFCDGMFDCIDESDEGDEFCSSHTCYPGYEQCDRNKCY
MLEARCDGVNQCKDGTDEMHCERAKECSPDEFQCRDRLNCVSQYKVCDLANDCEDASDEN
NYLCAHHPIINKVCNTSEACPAGFECTLRHILANQTTCGCPSDYRMNVFTHKCEDACDSG
SYCTHACHKSVCLCDYLFKLVKDKNGKPACAIDTYYKLLMSTDTGEIFSFGPTNQTRLHY
FNQIKFDQLGSTKVRITAMDYVVSTILSSPPPSPPPPPPSPPPPSYYYSRETSFPSLLRY
PAGQTAYGIELFFCSLFDGSMHQAHVDVNDDDWSSHHQTPPLLESRRIFPTLMDDMSVDW
LTNNIYATDSLTNRIMATDFHGRTTVDIITKNIETPMAIKRLFWVDAKKNTVESVKVDGT
DRRKVFAFQKSDDGKHLNMPVRLDILGDYLFVLTHKPCSIYYIHKFGTVLGDKWLKFKNN
TVAQLNPCLKVDCGEHGMCVNVPEGARCMCATEYVWNETTSSCQLKFDLLYLLLYGPVCK
DHCYNAGNCSRVNGLAKCKFVSLVCLSSCRCCYAGERCEHDLCAGYCVEKHTNDKCTVNH
EEVPVCRCKDGYIGSKCEHHQCDNHCYNGGSCYFNPVSRNLSCLCRPGYFGDACQRSYKH
NRTTACDHVTCHNSGTCTVDAHGDVHCKCLAGYTVHRSITCNKCYHACANSSLNSCHQSH
CQHHPQVFCSRTAGHNLAADFHAAFFCSCPPGFVNLCRTNGRNTTTNNNNNDNNNDNSDY
DLSVLNALTDDDEYCTGCIAVCDYHCSKLGTASCSMDEMSDNVKCNCKRGWSGESCDLCG
QDEYRCSNRGTCRNVDDVITCACSPGFHGNQCQMDGGCSLVRCQNNGTCYKKSEISYQCL
QTNKYKQM
Download sequence
Identical sequences T1FG57
jgi|Helro1|180677 XP_009028233.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]